DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG33462

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:280 Identity:66/280 - (23%)
Similarity:98/280 - (35%) Gaps:80/280 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTAAHCTAGADEAS 93
            |..|.| .|..|..|..||....:.|:      .....:.|.|::|.|.:|||||||.  .|:..
  Fly    28 DCGIPH-NISERSVNAKLAQNPWMAYL------ETPKGFHCSGTLINHLFVLTAAHCV--PDDLL 83

  Fly    94 LYYGAVNYN-------------EP--------AFRHTVSSENFIRYPHYVGLDHDLALIKT-PHV 136
            :......||             ||        .|||        ||.:.....:|:.:::. ..|
  Fly    84 ITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRH--------RYYNANDQTNDIGMLRLGRRV 140

  Fly   137 DFYSLV--------NKIELPSLDDRYNSYENNWVQAAGW--GAIYDGSNVVEDLRVVDLKVISVA 191
            ::.:.:        |:.:.| :|      :..|.....|  .|....|.|   ||.:::......
  Fly   141 EYLNHIRPICIFASNRFQEP-ID------QLTWFTTTVWRETAANATSKV---LRTMNIDRQPKE 195

  Fly   192 ECQAYYGTDTASE-----NTICVETPDGKATCQGDSGGPLVTK----EGDKLI--GITSFVSAYG 245
            .|...||.:...|     ||:       ...|..|||.|.:.|    ..|:.:  ||.|.|... 
  Fly   196 TCSEIYGWNMTFEQICAGNTL-------SQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQ- 252

  Fly   246 CQVGGPAGFTRVTKYLEWIK 265
            ||..|.  ...:..|.:|||
  Fly   253 CQNSGI--LMDLLSYADWIK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 59/266 (22%)
Tryp_SPc 41..266 CDD:238113 61/268 (23%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 58/259 (22%)
Tryp_SPc 48..269 CDD:214473 55/256 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436141
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.