DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and Sp212

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:283 Identity:77/283 - (27%)
Similarity:120/283 - (42%) Gaps:43/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SALTVPHSLVHPRDLEIRHG------GIEGR----ITNGNLASEGQVPYIVGV-SLNSNGNWWWC 69
            :.:|||.:...|:..:.|..      |.||.    |..||....||.|::..| ........:.|
  Fly   242 AVVTVPPATPPPQRFDPRSQISSVVCGREGSTTPFIVRGNEFPRGQYPWLSAVYHKEVRALAFKC 306

  Fly    70 GGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEPAF-RHTVSSENFIR---YPHY---VGLDHD 127
            .||:|..:.|::||||.....|..:..|...|:...: .......|.:|   :|.|   ...|.|
  Fly   307 RGSLISSSIVISAAHCVHRMTEDRVVVGLGRYDLDDYGEDGAEMRNVMRLLWHPDYNTRSYSDAD 371

  Fly   128 LALIKTPH-VDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVA 191
            :|||.... |.|..::..|.:.:::.........::  ||||...|.|. .:..|||:.::.|..
  Fly   372 IALITIERPVTFNDIIAPICMWTVEASRTVSTTGFI--AGWGRDEDSSR-TQYPRVVEAEIASPT 433

  Fly   192 ECQAYYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGDK--LIGITSFVSAYGCQVG--GPA 252
            .|.:.:.....:|.::|....||...|.|||||.|:.|:||:  |.||.|        .|  |||
  Fly   434 VCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQGDRWLLRGIVS--------AGERGPA 490

  Fly   253 G---------FTRVTKYLEWIKE 266
            |         :..::|::.||.|
  Fly   491 GTCQLNQYVLYCDLSKHINWISE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 66/249 (27%)
Tryp_SPc 41..266 CDD:238113 68/246 (28%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 69/248 (28%)
Tryp_SPc 277..511 CDD:214473 66/244 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436841
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.