DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG30323

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:271 Identity:56/271 - (20%)
Similarity:98/271 - (36%) Gaps:91/271 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 IVGVSLNSNGNWW----WCGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEPAFRHTV----- 110
            :|.:....:...|    :|.||::...||:|:..|.:...|::       .|:|:.|..:     
  Fly    36 VVSIRTRKHIRHWGDNHFCAGSLLSAWWVVTSGCCVSTRPEST-------PNQPSNRKNLRVVVF 93

  Fly   111 --------SSENFIRYPHYVGLDH-------DLALIKTPHVD-------FYSLVNKIELPSLDDR 153
                    |.:| |.:...:.||.       :|||:|   :|       |..::.:.||.|    
  Fly    94 TPKRLKKPSPKN-IYHVQKIVLDESAISGCTELALLK---LDRGVTGQRFAMMLPEKELNS---- 150

  Fly   154 YNSYENNWV-QAAGWGAIY--------------------------DGSNVVEDLRVVDLKVISVA 191
                  .|: .:.|||.||                          ||....|.:::...| ||..
  Fly   151 ------TWLCNSLGWGRIYYVSYVYISAMCPAFSMVYDNPVTWFQDGPYSSELIQIRAQK-ISEY 208

  Fly   192 ECQAYYGTDTASENTICVETPDGKAT-CQGDSGGPLVTKEGDKLIGITSFVSAYGCQVGGPAGFT 255
            ||:      ......:|:.:..|:.. ||.|.|.||....  .|.|:...|  :.|...|...:|
  Fly   209 ECK------PDCSRCLCMTSYTGRGNMCQQDLGSPLFCDH--FLYGVARRV--HTCDDEGFMFYT 263

  Fly   256 RVTKYLEWIKE 266
            .:.:..::|::
  Fly   264 NIYQNRKFIED 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 55/267 (21%)
Tryp_SPc 41..266 CDD:238113 56/269 (21%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 55/262 (21%)
Tryp_SPc 45..272 CDD:214473 54/258 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471263
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.