DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG30098

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:217 Identity:62/217 - (28%)
Similarity:95/217 - (43%) Gaps:34/217 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NWWWCGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEPAFRHTVSSE--NFIRYPHYVGL-DH 126
            |.:.||||:|.:.:||||||||...|...:..|..:.:......|.|..  :..|:.:|:.. :|
  Fly    56 NRFACGGSLIAYRFVLTAAHCTKINDNLFVRLGEYDSSRTTDGQTRSYRVVSIYRHKNYIDFRNH 120

  Fly   127 DLALIKTPHVDFYS--------LVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVV 183
            |:|::|......|.        |:|.    .|....||.:|  ....|||.:.....:...|:.:
  Fly   121 DIAVLKLDRQVVYDAYIRPICILLNS----GLQSLANSIQN--FTLTGWGQMAHYYKMPTTLQEM 179

  Fly   184 DLKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPL--VTKEGDKLI----GITSFVS 242
            .|:.:.    ..|.|..:.|   ||...|...| |.|||||||  :.|.|.|.|    |:|:.|:
  Fly   180 SLRRVR----NEYCGVPSLS---ICCWNPVQYA-CFGDSGGPLGSLVKYGHKTIYVQFGVTNSVT 236

  Fly   243 AYGCQVGGPAGFTRVTKYLEWI 264
            . .|.  |.:.:..:..|:.|:
  Fly   237 G-NCD--GYSSYLDLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 61/215 (28%)
Tryp_SPc 41..266 CDD:238113 62/217 (29%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 61/214 (29%)
Tryp_SPc 37..258 CDD:238113 62/217 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436150
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.