DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG30088

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:267 Identity:68/267 - (25%)
Similarity:100/267 - (37%) Gaps:78/267 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEP 104
            ||..|..|.....|::..:..:|..:   |||:||...::||||||.                .|
  Fly    44 RIVRGKEAMLKSAPFMAYLYYSSEIH---CGGTIISSRYILTAAHCM----------------RP 89

  Fly   105 AFRHTVSSENFIRYPHYVG------------------------LDHDLALIK-------TPHVDF 138
            ..:..:...:..|.|...|                        |.:|:||:|       ..|:..
  Fly    90 YLKVRLGEHDITRNPDCQGGSCSPPAEEFDIVLATKYKRFDRFLANDIALLKLSRNIRFNVHIQP 154

  Fly   139 YSLV-NKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAECQAYYGTDTA 202
            ..|: |....|::.:         .||.|||.. :.::....|:...|.......|::.... ..
  Fly   155 ICLILNPAAAPNVHE---------FQAFGWGQT-ETNHSANVLQTTVLTRYDNRHCRSVLSM-PI 208

  Fly   203 SENTICVETPDGKATCQGDSGGPLVTKEG-DKL-----IGITSFVSAYG---CQVGGPAGFTRVT 258
            :.|.:||.. .|..||.||||||||||.. |.:     :||.||    |   ||  .|..:|.|.
  Fly   209 TINQLCVGF-QGSDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSF----GDDKCQ--SPGVYTYVP 266

  Fly   259 KYLEWIK 265
            .|:.||:
  Fly   267 NYIRWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 66/264 (25%)
Tryp_SPc 41..266 CDD:238113 67/266 (25%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 66/264 (25%)
Tryp_SPc 45..273 CDD:238113 66/264 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436138
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.