DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG30087

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:268 Identity:76/268 - (28%)
Similarity:108/268 - (40%) Gaps:79/268 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTAAHCT------------------ 86
            |:.||..|.....|::|.|:.||..:   |||||:...::||||||.                  
  Fly    41 RVVNGKEAVIRSAPFMVYVTNNSLTH---CGGSILNSRYILTAAHCVFPNLRLRLGEHNIRTDPD 102

  Fly    87 ---AGADEASLYYGAVNYNEPAFRHTVSSENFIRYPHYVGLDHDLALIK-------TPHVD-FYS 140
               :.....|..||.:.    |..|     .|....::|   :|:||:|       ..|:. ...
  Fly   103 CQGSNCSPRSEEYGIMK----AITH-----RFYNAANHV---NDIALLKLNRSINFNVHIQPICI 155

  Fly   141 LVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAEC----QAYYGTDT 201
            |:|....||:    .:|     |..|||.. ..:.....|:..:|:....|.|    .||     
  Fly   156 LLNPASAPSV----ATY-----QTFGWGET-KKNGFPHLLQTAELRAYDAAYCSRSFHAY----- 205

  Fly   202 ASENTICVETPDGKATCQGDSGGPLVTK---EGDK---LIGITSFVSAYG---CQVGGPAGFTRV 257
            .:.|.||....: :.||.|||||||||:   :|.|   .:||.|    ||   ||  .|..:|.|
  Fly   206 MNGNQICAGHEE-RDTCAGDSGGPLVTRVDFDGVKRYLQLGIVS----YGPTDCQ--SPGVYTYV 263

  Fly   258 TKYLEWIK 265
            ..|:.||:
  Fly   264 PNYINWIR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 74/265 (28%)
Tryp_SPc 41..266 CDD:238113 75/267 (28%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 74/265 (28%)
Tryp_SPc 42..272 CDD:238113 75/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436139
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.