DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and T22A3.6

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:96 Identity:23/96 - (23%)
Similarity:35/96 - (36%) Gaps:23/96 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NSNGNWWWCGGSIIGHTWVLTAAHC---TAGADEASLYYGAVNYNEPAFRHT-VSSENFIRYPHY 121
            |..|.|.:.|..        |.|.|   ...:.|.|..:  |..|...|.:| ....:.:..|..
 Worm   152 NPLGPWCYVGND--------TTAPCFQPCRPSTETSSDF--VCLNRDGFPYTDYDMSDILDLPQL 206

  Fly   122 VGLDHDLALIKTPHVDFYSLVNKIELPSLDD 152
            :|:..|:.|:       |.  ::..||||.|
 Worm   207 IGIFKDVDLM-------YE--SRFVLPSLPD 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 23/96 (24%)
Tryp_SPc 41..266 CDD:238113 23/96 (24%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.