DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and try-5

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:237 Identity:62/237 - (26%)
Similarity:92/237 - (38%) Gaps:62/237 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CGGSIIGHTWVLTAAHC--------TAGADEASLYYGAVNYNEPAFRHTVSSENFIRYPHYVG-- 123
            |||::|....|||||||        ..|.:|.|:   :..|.|...|.| .||...|....||  
 Worm    73 CGGTLITLKHVLTAAHCFQKHFGAKKEGGEENSM---SGRYCESNQRFT-DSEILTRTVVTVGAM 133

  Fly   124 ---LDHDLALI------KTPHV------DFY----------------SLVNKIE------LPSLD 151
               |:.....:      ||..:      |||                |.::.:|      ||.|.
 Worm   134 CTRLEQKYGCVNEKQNGKTLKISRFAIGDFYKTHCEQGNDIVILELESTIDDVEGANYACLPFLP 198

  Fly   152 DRYNSYENNWVQAAGWGAI----YDGSNVVEDLRVVDLKVISVAECQAYYGTDTASENTICVETP 212
            : .|......|.:.|||:.    :|.: ....::|:.|...::|.|:..:||....: :.|....
 Worm   199 E-VNIQSGANVTSFGWGSDPGKGFDNA-AFPMIQVLTLATETLATCEENWGTSIPFD-SFCTAEE 260

  Fly   213 DGKATCQGDSGGPLVTKEGDK----LIGITSFVSAYGCQVGG 250
            :.|..|.|||||.|...:.|.    :|.|.|:.|.....:||
 Worm   261 EDKNVCSGDSGGGLTFHQSDSAREFIIAIVSYGSDCVQLIGG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 62/237 (26%)
Tryp_SPc 41..266 CDD:238113 62/237 (26%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 60/229 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.