DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and try-4

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:298 Identity:74/298 - (24%)
Similarity:111/298 - (37%) Gaps:88/298 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EGRITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTAAH---CTAGA---------- 89
            |.:|.|        .|:.|..:::....   .|||||....::||||   .|.|:          
 Worm    52 ESKIKN--------FPWAVSFTVDGVNR---LGGSIISPYHIITAAHGFITTIGSRGNLCENKNW 105

  Fly    90 --DEASLY-------------YGAV-------NY-NEPAFRHTVSSENFIRYPHYVGLD------ 125
              ..:|:|             ||..       .| |:|..:.:....|.:|   .|.:|      
 Worm   106 KKPNSSIYRSIKFLRDTRKVAYGGTCIRGHTDKYPNDPRCKKSDVIHNKVR---AVLVDGEFASS 167

  Fly   126 -----HDLALIKT-PHVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAIY---DGSNVVEDLR 181
                 ||.|:::. ..:.|...|..|.||    |.|.|....:...|||..|   :...::.::.
 Worm   168 NCLKGHDWAIVEVEKRIHFSENVRPICLP----RPNMYYTKSLAVPGWGRSYIFNESGPLIHEIP 228

  Fly   182 V-VDLKVISVAECQAYYG--TDTASENTIC-----VETPDGKATCQGDSGGPLVTKEGDK----L 234
            : :|      .:|:..:.  ....:::.||     |.......||.|||||.|..::.:.    |
 Worm   229 MRID------RDCKRPWSDRLPADADDFICATSMNVSNYSAPRTCHGDSGGGLEYRDDNYGRAFL 287

  Fly   235 IGITSFVSAYGCQVGGPAGFTRVTKYLEWIKEETGIYY 272
            |.|||| ...||.....|.||||..||..|...||:.|
 Worm   288 IAITSF-GTRGCPSNMLARFTRVDMYLNLICNYTGVCY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 69/286 (24%)
Tryp_SPc 41..266 CDD:238113 70/287 (24%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 71/290 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.