DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and try-10

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001256475.1 Gene:try-10 / 179787 WormBaseID:WBGene00008849 Length:355 Species:Caenorhabditis elegans


Alignment Length:244 Identity:58/244 - (23%)
Similarity:87/244 - (35%) Gaps:77/244 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 IVGVSLNS--------------NGNWWWCGGSIIGHTWVLTAAHCTAGADE----ASLYYGAVNY 101
            |.|.|.||              :|....|||.:|..:.|:|:|||....|:    |.:..|.|:.
 Worm    76 INGFSANSFDTLSLASVITRFPDGTTNVCGGVLIAPSIVITSAHCVFSGDDFAVTAKVTLGDVHL 140

  Fly   102 N-----EPAFR-HTVS-SENF-------------IRYPHYVGLDH---DLALIKTPHVDFYSLVN 143
            |     |..|| |.:: |:.|             |..|....:.|   .|.:.|.|.....:...
 Worm   141 NKHDDGEQEFRSHAMAISKKFFNDASEANDDVAVIFLPQRADVCHSPLSLQIAKLPSTGSVNFKE 205

  Fly   144 KIELPSLDDRYNSYENNWVQAAGWG------AIYDGSNVVEDLRVVDLKVISVAE-----CQAYY 197
            ...|..|     ..|.:....||||      |.|  |:.|..: :|:|.|..:.:     .:|..
 Worm   206 TAPLTQL-----QLETSVCYVAGWGKTENKTAKY--SDSVRQM-MVNLSVRRIGKRKYLIAKAVT 262

  Fly   198 GTDTASENTICVETPDGKATCQGDSGGPLVTKEGDK--LIGITSFVSAY 244
            |:..|               |.||||.|:......|  |:|..:.:.::
 Worm   263 GSSRA---------------CMGDSGSPVYCFVNGKRILVGTVAHIGSF 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 58/244 (24%)
Tryp_SPc 41..266 CDD:238113 58/244 (24%)
try-10NP_001256475.1 Tryp_SPc 75..290 CDD:389826 58/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.