DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and Tpsb2

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:281 Identity:91/281 - (32%)
Similarity:128/281 - (45%) Gaps:56/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ALTVPHSLVH--PRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGNWW--WCGGSIIGHT 77
            ||::..|||:  ||....|.|     |..|:.|||.:.|:  .|||....|:|  :||||:|...
Mouse    11 ALSLLASLVYSAPRPANQRVG-----IVGGHEASESKWPW--QVSLRFKLNYWIHFCGGSLIHPQ 68

  Fly    78 WVLTAAHCT-----------AGADEASLYYGAVNYNEPAFRHTVSSENFIRYPHYV----GLDHD 127
            ||||||||.           ....|..||||         ...:|....:.:|||.    |.|..
Mouse    69 WVLTAAHCVGPHIKSPQLFRVQLREQYLYYG---------DQLLSLNRIVVHPHYYTAEGGADVA 124

  Fly   128 LALIKTPHVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVE---DLRVVDLKVIS 189
            |..::.| |:..:.::.|.||...:.:....:.||  .|||.| |....:.   .|:.|.:.::.
Mouse   125 LLELEVP-VNVSTHLHPISLPPASETFPPGTSCWV--TGWGDI-DNDEPLPPPYPLKQVKVPIVE 185

  Fly   190 VAECQAYYGTDTASENTICVETPDG--------KATCQGDSGGPLVTK-EGDKL-IGITSFVSAY 244
            .:.|...|.|...:.:...: ..||        :.:||||||||||.| :|..| .|:.|:  ..
Mouse   186 NSLCDRKYHTGLYTGDDFPI-VHDGMLCAGNTRRDSCQGDSGGPLVCKVKGTWLQAGVVSW--GE 247

  Fly   245 GC-QVGGPAGFTRVTKYLEWI 264
            || |...|..:||||.||:||
Mouse   248 GCAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 80/254 (31%)
Tryp_SPc 41..266 CDD:238113 82/255 (32%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 82/255 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.