DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CTRL

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:273 Identity:83/273 - (30%)
Similarity:134/273 - (49%) Gaps:34/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSLAFLGV---CSALTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGNWWW 68
            |||..||.   |....:..:|           ....||.||..|..|..|:  .|||..:..:.:
Human     8 LSLVLLGSSWGCGIPAIKPAL-----------SFSQRIVNGENAVLGSWPW--QVSLQDSSGFHF 59

  Fly    69 CGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYN---EPAFRHTVSSENFIRYPHY--VGLDHDL 128
            ||||:|..:||:|||||........:..|..:.:   ||.  ..:|....|.:|.:  ..:::|:
Human    60 CGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPL--QVLSVSRAITHPSWNSTTMNNDV 122

  Fly   129 ALIK--TPHVDFYSLVNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVV-EDLRVVDLKVISV 190
            .|:|  :| ..:.:.::.:.|.|.::...  |.......|||.:....||. ..|:.|.|.:::|
Human   123 TLLKLASP-AQYTTRISPVCLASSNEALT--EGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTV 184

  Fly   191 AECQAYYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGDK--LIGITSFVSAYGCQVGGPAG 253
            .:|:.|:|: :.:::.||.... |.::||||||||||.::|:.  ||||.|: ....|.|..||.
Human   185 NQCRQYWGS-SITDSMICAGGA-GASSCQGDSGGPLVCQKGNTWVLIGIVSW-GTKNCNVRAPAV 246

  Fly   254 FTRVTKYLEWIKE 266
            :|||:|:..||.:
Human   247 YTRVSKFSTWINQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 74/233 (32%)
Tryp_SPc 41..266 CDD:238113 75/234 (32%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 75/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.