DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG43742

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:238 Identity:76/238 - (31%)
Similarity:115/238 - (48%) Gaps:31/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYN-- 102
            |:.||:.|...|  ::..:..||.   ::||||:|...:|||||||....||.:::.|..|.:  
  Fly    34 RVANGHTAITSQ--FMAALYNNSE---FFCGGSLIHKQYVLTAAHCVRDLDEVTVHLGENNRSCP 93

  Fly   103 EPAFRHTVS-SENFIRYPHYVG--LDHDLALIKTP-HVDFYSLVNKIELPSLDDRYNSYENNWVQ 163
            .|..:|.:. :...|.:|::.|  ..:|:||::.. .|.|.:.:..|.: .||:...|...|...
  Fly    94 IPVCKHVLRLNAKVILHPNFHGNIFLNDIALLRLEREVIFEAHIRPICI-ILDEDVTSNNQNNFT 157

  Fly   164 AAGWGAIYDGSNVVEDLRVVDLKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPLV- 227
            |.|||....| |:.:.|..:||..:..:.|.       .:.||||..:..|. ||:.||||||: 
  Fly   158 AYGWGKTEHG-NISDVLSFIDLVRLPKSMCY-------QNINTICAGSTSGD-TCESDSGGPLIG 213

  Fly   228 -----TKEGDKLIGITSFVSAYGCQVGGPAG-FTRVTKYLEWI 264
                 .|..|.|.||||:..|   :..|..| :|.|..|..||
  Fly   214 NFVHRGKSRDILFGITSYGDA---ECSGLFGVYTDVNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 74/236 (31%)
Tryp_SPc 41..266 CDD:238113 75/237 (32%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 74/236 (31%)
Tryp_SPc 35..256 CDD:238113 75/237 (32%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436144
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.