DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG43110

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:239 Identity:73/239 - (30%)
Similarity:108/239 - (45%) Gaps:33/239 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNEP 104
            :|.:|:.||:....|:.|:   .|.....|||:||...:|||.|||.: .....:..||.|.|.|
  Fly    35 KIISGSNASQQSAQYMAGI---FNTTHLLCGGTIIHEDFVLTVAHCKS-TQTLFVRLGAYNINHP 95

  Fly   105 AFRHTVSSENFIRYPHYVGLDH--DLALIKTPHVDFYSLVNK---IELPSLDDRYNSYENNWVQA 164
            ..:..|...  |.:|.|....:  |:||:|......::|..:   |.|.:...:...|.|    |
  Fly    96 TDQIRVIET--IAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHLDATLGKQIRYYN----A 154

  Fly   165 AGWGAIYDG--SNVVEDLRVVDLKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPLV 227
            .|||...:.  |::::.:.|   ...:...|..|.|. :.....||..|..|. ||.|||||||:
  Fly   155 FGWGRTRNAEQSDILQRIFV---NRTNPMICHLYLGM-SPDPKQICATTDQGD-TCAGDSGGPLI 214

  Fly   228 TK---EG---DKLIGITSFVSAYGC-QVGGPAGFTRVTKYLEWI 264
            :|   :|   |...||||    ||. :..|...:|.|::|..||
  Fly   215 SKITYQGKNFDTQFGITS----YGTRECNGVGLYTDVSQYSGWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 71/237 (30%)
Tryp_SPc 41..266 CDD:238113 73/238 (31%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 71/237 (30%)
Tryp_SPc 36..257 CDD:238113 73/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436148
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.