DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and Cela1

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_291090.2 Gene:Cela1 / 109901 MGIID:95314 Length:266 Species:Mus musculus


Alignment Length:276 Identity:78/276 - (28%)
Similarity:122/276 - (44%) Gaps:33/276 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTLLSLAFLGVCSALT--VPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGNW 66
            |..|..|.|.:|...|  ||.:              :.|:..|..|.....|..:.:.....|:|
Mouse     2 LRFLVFASLVLCGHSTEDVPET--------------DARVVGGAEARRNSWPSQISLQYQYGGSW 52

  Fly    67 -WWCGGSIIGHTWVLTAAHCTAGADEASLYYGAVNYNE-PAFRHTVSSENFIRYPHY----VGLD 125
             ..|||::|...||:|||||........:..|..|.:: ......|:.:..:.:|::    |...
Mouse    53 HHTCGGTLIRSNWVMTAAHCVDSPMTYRVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNVVAG 117

  Fly   126 HDLALIKTPHVDFYSLVNKIELPSLDDRYNSYENNW-VQAAGWGAIYDGSNVVEDLRVVDLKVIS 189
            :|:||::.  ....:|.|.::|..|........||. ....|||.......:.:.|:...|..:|
Mouse   118 YDIALLRL--AKSVTLNNYVQLGVLPREGTILANNSPCYITGWGRTRTNGELAQTLQQAYLPSVS 180

  Fly   190 VAEC--QAYYGTDTASENTICVETPDG-KATCQGDSGGPL-VTKEGDKLI-GITSFVSAYGCQVG 249
            .:.|  .:|:|:..  :||:.....|| ::.||||||||| ....|...: |:|||||:.||.|.
Mouse   181 YSICSSSSYWGSSV--KNTMVCAGGDGVRSGCQGDSGGPLHCMVNGQYAVHGVTSFVSSMGCNVA 243

  Fly   250 -GPAGFTRVTKYLEWI 264
             .|..||||:.|:.|:
Mouse   244 RKPTVFTRVSAYISWM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 69/236 (29%)
Tryp_SPc 41..266 CDD:238113 69/237 (29%)
Cela1NP_291090.2 Tryp_SPc 26..258 CDD:214473 69/235 (29%)
Tryp_SPc 27..262 CDD:238113 69/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.