DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and Ctrl

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_075671.1 Gene:Ctrl / 109660 MGIID:88558 Length:264 Species:Mus musculus


Alignment Length:272 Identity:89/272 - (32%)
Similarity:132/272 - (48%) Gaps:32/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSLAFLGV---CSALTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGNWWW 68
            |||..||.   |....:..:|.:.:           ||.||..|..|..|:  .|||..|..:.:
Mouse     8 LSLVLLGSSWGCGVPAITPALSYNQ-----------RIVNGENAVPGSWPW--QVSLQDNTGFHF 59

  Fly    69 CGGSIIGHTWVLTAAHC--TAGADEASL-YYGAVNYNEPAFRHTVSSENFIRYPHYVG--LDHDL 128
            ||||:|...||:|||||  |.|.....| .|...:..||.  ..:|....|.:|::..  :::||
Mouse    60 CGGSLISPNWVVTAAHCQVTPGRHFVVLGEYDRSSNAEPV--QVLSIARAITHPNWNANTMNNDL 122

  Fly   129 ALIKTPHVDFYSL-VNKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVV-EDLRVVDLKVISVA 191
            .|:|......|:. |:.:.|.|.::...|  .......|||.|....||. ..|:.|.|.:::|.
Mouse   123 TLLKLASPARYTAQVSPVCLASTNEALPS--GLTCVTTGWGRISGVGNVTPARLQQVVLPLVTVN 185

  Fly   192 ECQAYYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGDK--LIGITSFVSAYGCQVGGPAGF 254
            :|:.|:|. ..::..||. ...|.::||||||||||.::|:.  ||||.|: ....|.:..||.:
Mouse   186 QCRQYWGA-RITDAMICA-GGSGASSCQGDSGGPLVCQKGNTWVLIGIVSW-GTKNCNIQAPAMY 247

  Fly   255 TRVTKYLEWIKE 266
            |||:|:..||.:
Mouse   248 TRVSKFSTWINQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 80/232 (34%)
Tryp_SPc 41..266 CDD:238113 81/233 (35%)
CtrlNP_075671.1 Tryp_SPc 33..257 CDD:214473 80/232 (34%)
Tryp_SPc 34..260 CDD:238113 81/235 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.