DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and CG42694

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:271 Identity:61/271 - (22%)
Similarity:110/271 - (40%) Gaps:50/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LTVPHSLVHPRDLEIRHGGIEGRITNGNLAS--EGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVL 80
            |||..|.|:.:.|:...|   ..|:|.::..  :.|..::..:   |||....|.||:|...:||
  Fly    11 LTVLQSHVNSKFLDDYCG---APISNQSITKLRQPQAGWLAHI---SNGTHVLCSGSLISKQFVL 69

  Fly    81 TAAHCTAGADEASLYYGAVNYNEPAFRHTVSSENFIRYPHYVG--LDHDLALIK-TPHVDFYSLV 142
            :||.|.....:..:..|..|..:....:|||:   :..|.:.|  |..|:.|:| :..||:...|
  Fly    70 SAAQCIDVHGKLFVQLGVSNATKSPHWYTVSN---VVIPSHSGKRLQRDIGLLKLSQSVDYNDFV 131

  Fly   143 ---------NKIELPSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVVDLKVISVAECQA-YY 197
                     |.:::..:...:.:  :.|:...            ::.:.:.|..:|...|:. ..
  Fly   132 YPICIALNTNTLDMVKILQNFTT--SAWLSKN------------KNPQTIVLSQLSRDRCKLNLS 182

  Fly   198 GTDTASENTICVETPDGKATCQGDSGG----PLVTKEG---DKLIGITSFVSAYG-CQVGGPAGF 254
            |..|..|  ||..:.....:|..|||.    |::....   :.|.||..:|:... |  ..||.:
  Fly   183 GNVTPKE--ICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVNGRSWC--SEPAIY 243

  Fly   255 TRVTKYLEWIK 265
            ..|.:.:.||:
  Fly   244 IDVAECVGWIE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 52/246 (21%)
Tryp_SPc 41..266 CDD:238113 54/248 (22%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 51/233 (22%)
Tryp_SPc 46..253 CDD:214473 49/230 (21%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.