DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Ci and zgc:171592

DIOPT Version :9

Sequence 1:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001104713.2 Gene:zgc:171592 / 100003031 ZFINID:ZDB-GENE-080220-23 Length:260 Species:Danio rerio


Alignment Length:277 Identity:76/277 - (27%)
Similarity:119/277 - (42%) Gaps:54/277 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FLGVCSALTVPHSLVHPRDLEIRHGGIEGRITNGNLASEGQVPYIVGVSLNSNGNWWWCGGSIIG 75
            |..|.|||......:.|:.       |..||.||..|..|..|:.|.:.|.:..:  :||||:|.
Zfish     8 FALVASALGCGVPAIKPQI-------IGSRIVNGQNAISGSWPWQVSLQLPNGVH--FCGGSLIN 63

  Fly    76 HTWVLTAAHCTAGADEASLYYGAVNYN-------------EPAFRHTVSSENFIRYPHY--VGLD 125
            ..||||||||:.          .|.|:             ||.....||  ..:.:|.:  ..|:
Zfish    64 RNWVLTAAHCSV----------VVGYHRVVLGEHDRGSNAEPIQVKLVS--KVVTHPLFSRTTLN 116

  Fly   126 HDLALIK--TPHVDFYSLVNKIEL-PSLDDRYNSYENNWVQAAGWGAIYDGSNVVEDLRVVDLKV 187
            :|:||:|  :| |...:.|:.:.| ||   ..|..........|||.....|: ...|:...:.:
Zfish   117 NDIALLKLASP-VTLTARVSPVCLAPS---AINIQSGTRCFTTGWGRTASTSS-PRILQQTSVPL 176

  Fly   188 ISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPLVTKEGDKLIGITSFVSAYG-----CQ 247
            :|.|:|:..:|.:..::..||. ...|.::|:||||||||.:..    |:.:.|.:..     |.
Zfish   177 VSHADCRQIWGRNRVTDAMICA-GGSGSSSCRGDSGGPLVCERS----GVWTLVGSVSWGLDTCN 236

  Fly   248 VGGPAGFTRVTKYLEWI 264
            ...|..:.|:::...||
Zfish   237 TRFPGVYARISQQRSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 67/246 (27%)
Tryp_SPc 41..266 CDD:238113 68/247 (28%)
zgc:171592NP_001104713.2 Tryp_SPc 31..256 CDD:238113 68/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.