DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and si:dkey-238d18.3

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001373176.1 Gene:si:dkey-238d18.3 / 795978 ZFINID:ZDB-GENE-131127-38 Length:272 Species:Danio rerio


Alignment Length:271 Identity:84/271 - (30%)
Similarity:125/271 - (46%) Gaps:24/271 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLALAVAAATAVP---APAQKLTPTPIK-DIQGRITNGYPAYEGKVPYIVGLLFSGNGNW 61
            :....|:|..:......|   |..:..|..||. ||...|..|..|.  :.|:.|.:..| :|..
Zfish     5 ISFLAFVASTLGCGVRQPLGWAAKESTTKKPIDGDIHEGIMQGVDAL--RWPWQVSIKTS-SGEH 66

  Fly    62 WCGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGS-GDIIQHHHYNSGNL-HNDI 124
            .||||:|...||||||||...|....:..|...|:....|..|.. ..:|.|...|...| :||:
Zfish    67 LCGGSLINKFWVLTAAHCQIQARSHYVVLGQHDRSSNDGTVQVKEIAKVITHPDNNIQTLFNNDV 131

  Fly   125 SLIR-TPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYD--GSPLPDWLQSVDVQIISQ 186
            :|:: :......|||:.|.|.|.:.:.  ..|...|.:|||.|..  .:.:   ||...:.|:||
Zfish   132 TLLKLSSPAQMTSLVSPVCLASSSSKI--VPGTLCVTTGWGRTKTELSARI---LQEATIPIVSQ 191

  Fly   187 SDCSRTW---SLHDNMICINTDGGKSTCGGDSGGPLVTHDGN--RLVGVTSFGSAAGCQSGAPAV 246
            |.|.:.:   .:.::|||.. ..|.|:|.|||||||:.....  ..||:.|:|: ..|:...|.|
Zfish   192 SQCKQIFGASKITNSMICAG-GSGSSSCQGDSGGPLMCESSGVWYQVGIVSWGN-RDCRVDFPLV 254

  Fly   247 FSRVTGYLDWI 257
            ::||:.:..||
Zfish   255 YARVSYFRKWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 75/232 (32%)
si:dkey-238d18.3NP_001373176.1 Tryp_SPc 52..268 CDD:238113 72/222 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.