DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and cela1.4

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001020358.1 Gene:cela1.4 / 574008 ZFINID:ZDB-GENE-050626-127 Length:267 Species:Danio rerio


Alignment Length:287 Identity:91/287 - (31%)
Similarity:126/287 - (43%) Gaps:66/287 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LALAVAAATAVPAPAQKLTPTPIKD--IQGRITNGYPAYEGKVPYIVGLLFSGNGNWW--CGGSI 67
            |.|:..||.|:..|..      ::|  |:.|:..|..|.....|:.:.|.|....:::  |||::
Zfish     5 LLLSTLAALALAEPRY------LEDLAIEERVVGGEVAKPNSWPWQISLQFLSALDYFHTCGGTL 63

  Fly    68 IGNTWVLTAAHCTN---------GASGVTINYG--ASIRTQPQYTH--W----VGSG-DIIQHHH 114
            |...||||||||.:         |...:|.:.|  .|:.....|.|  |    |.|| ||.....
Zfish    64 IRPGWVLTAAHCVDIPRNWRVILGDHDITKHEGHEQSLTVSRVYIHPNWNTDSVSSGYDIALLQL 128

  Fly   115 YNSGNLHNDISLIRTPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSV 179
            .....|::.:.|...|.      ..:| ||..|:.|         .:|||.|..|......|:..
Zfish   129 STDATLNSYVQLATLPP------AGQV-LPHNNECY---------ITGWGRTQTGGSTSSQLKQA 177

  Fly   180 DVQIISQSDCSRT--WS--LHDNMICINTDGGK-STCGGDSGGPL--------VTHDGNRLVGVT 231
            .:.::..:.|||:  |.  :.|.|||  :.||: |.|.|||||||        |.|      |||
Zfish   178 LLPVVDHNTCSRSDWWGSIVKDTMIC--SGGGEVSGCQGDSGGPLNCLVNGKYVVH------GVT 234

  Fly   232 SFGSAAGCQSG-APAVFSRVTGYLDWI 257
            ||.|||||.:. .|.||:||:.|..||
Zfish   235 SFVSAAGCNTNKKPTVFTRVSAYNSWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 82/256 (32%)
cela1.4NP_001020358.1 Tryp_SPc 29..261 CDD:214473 81/255 (32%)
Tryp_SPc 30..264 CDD:238113 82/256 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.