DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and ela3l

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_021331840.1 Gene:ela3l / 554107 ZFINID:ZDB-GENE-060710-2 Length:270 Species:Danio rerio


Alignment Length:279 Identity:86/279 - (30%)
Similarity:131/279 - (46%) Gaps:39/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWW--C 63
            |...:..::.:|:|.....|       ||:.:..|:.||..|.....|:.|.|.:....:::  |
Zfish     1 MFALILASVLIASAFGCGKP-------PIEPLMSRVVNGEEARPHSWPWQVSLQYQSGSSFYHTC 58

  Fly    64 GGSIIGNTWVLTAAHCTNGASGVTINYG---ASIRTQPQYTHWVGSGDIIQHHHYNS--GNLHND 123
            |||||...||:|||||.:......:..|   .|:..:...|  :.:..||.|..:||  ..|.||
Zfish    59 GGSIIAENWVMTAAHCISSGRNYRVLVGKHDLSVNEEGSQT--ISAQKIIVHEKWNSMFVALGND 121

  Fly   124 ISLIRTPHVDFWSLVNKVEL---PSYND----RYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDV 181
            |:||:.  .:..:|.:.::|   |:..|    .|..|      .||||....|..|||.||...:
Zfish   122 IALIKL--AEPVTLSDTIQLGCVPAPGDVLPNNYPCY------ISGWGRLSTGGALPDRLQQALM 178

  Fly   182 QIISQSDCSR-TW---SLHDNMICINTDGGKSTCGGDSGGPLVTHDGN---RLVGVTSFGSAAGC 239
            ..:..:.||| .|   |:.:.|:|...||..:.|.|||||||...:.:   .:.|:.||.|..||
Zfish   179 PAVDHATCSRFDWWGSSVKETMVCAGGDGVVAGCNGDSGGPLNCKNSDGIWEVHGIASFVSGLGC 243

  Fly   240 QS-GAPAVFSRVTGYLDWI 257
            .: ..|.||:||:.:.||:
Zfish   244 NTIRKPTVFTRVSSFTDWV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 79/244 (32%)
ela3lXP_021331840.1 Tryp_SPc 29..265 CDD:238113 79/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.