DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and cela1.1

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001020645.2 Gene:cela1.1 / 553249 ZFINID:ZDB-GENE-050522-187 Length:282 Species:Danio rerio


Alignment Length:270 Identity:79/270 - (29%)
Similarity:129/270 - (47%) Gaps:31/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LALAVAAATAVPAPAQKLTPTPIKD--IQGRITNGYPAYEGKVPYIVGLLFSGNGNW--WCGGSI 67
            |.|:|.||..:..|..      ::|  |:.|:..|..|.....|:.:.|.:...|.:  :|||::
Zfish     5 LLLSVLAAIGLTEPRY------LEDLAIEERVIGGEIAKPHSWPWQISLQYQSGGRYHHYCGGTL 63

  Fly    68 IGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTH-----WVGSGDIIQHHHYNSGNL--HNDIS 125
            |...||:.||||.:.:...::..|....|    ||     ::....:..|.::|...:  .|||:
Zfish    64 IRPGWVMVAAHCVDTSRIWSVALGDHDTT----THEGPEQYISVKGVFIHPNWNPNIVANGNDIA 124

  Fly   126 LIR-TPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDC 189
            |:: :.:....|.|....||||.: ...| |.....:|||.|..|..|...|:...:.::....|
Zfish   125 LLQLSINATLSSYVQVATLPSYGE-ILPY-GHTCYITGWGRTQTGGSLSAQLKQAYMPVVDHETC 187

  Fly   190 SRT--W--SLHDNMICINTDGGKSTCGGDSGGPL-VTHDGNRLV-GVTSFGSAAGCQS-GAPAVF 247
            |::  |  ::.|.|||.......|.|.||||.|| ...:|..:| |||||.:::||.: ..|.||
Zfish   188 SQSDWWGSTVKDRMICAGGTTSMSACHGDSGSPLNCLFNGEYVVHGVTSFVASSGCNTYKKPTVF 252

  Fly   248 SRVTGYLDWI 257
            :||:.::.|:
Zfish   253 TRVSYHVSWL 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 70/239 (29%)
cela1.1NP_001020645.2 Tryp_SPc 29..261 CDD:214473 70/237 (30%)
Tryp_SPc 30..265 CDD:238113 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.