DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and ctrb.3

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:267 Identity:98/267 - (36%)
Similarity:129/267 - (48%) Gaps:24/267 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVFLALAVA---AATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGG 65
            |::|...||   ||.....||   .| |:.....||.||..|.....|:.|.|. ...|..:|||
Zfish     3 FLWLLSCVAFFSAAYGCGVPA---IP-PVVSGYARIVNGEEAVPHSWPWQVSLQ-DFTGFHFCGG 62

  Fly    66 SIIGNTWVLTAAHCTNGASGVTI----NYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDISL 126
            |:|...||:|||||:...|...|    |.|.|...:...|..|..  :..|..|||..:.|||:|
Zfish    63 SLINEFWVVTAAHCSVRTSHRVILGEHNKGKSNTQEDIQTMKVSK--VFTHPQYNSNTIENDIAL 125

  Fly   127 IR-TPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGT-YDGSPLPDWLQSVDVQIISQSDC 189
            :: |......:.|:.|.|...:|.:.  :|...|.||||.| |:....||.||.|.:.::|..||
Zfish   126 VKLTAPASLNAHVSPVCLAEASDNFA--SGMTCVTSGWGVTRYNALFTPDELQQVALPLLSNEDC 188

  Fly   190 SRTW--SLHDNMICINTDGGKSTCGGDSGGPLVTHDGN--RLVGVTSFGSAAGCQSGAPAVFSRV 250
            ...|  ::.|.|||... .|.|:|.||||||||....|  .|||:.|:||:. |....|.|:.||
Zfish   189 KNHWGSNIRDTMICAGA-AGASSCMGDSGGPLVCQKDNIWTLVGIVSWGSSR-CDPTMPGVYGRV 251

  Fly   251 TGYLDWI 257
            |...||:
Zfish   252 TELRDWV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 87/232 (38%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 87/231 (38%)
Tryp_SPc 34..261 CDD:238113 87/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.