DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and ctrl

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:286 Identity:92/286 - (32%)
Similarity:127/286 - (44%) Gaps:64/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFVFLALAVAAAT-AVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGS 66
            |::....|:.|:| ....||.|    |:.....||.||..|..|..|:.|.|..| ||..:||||
Zfish     2 LWIISCFALVASTLGCGVPAIK----PVISGYNRIVNGENAVSGSWPWQVSLQQS-NGFHFCGGS 61

  Fly    67 IIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGD-----------------IIQHHH 114
            :|...||:|||||               |.|..| |:|..|:                 .|.|.:
Zfish    62 LINQYWVVTAAHC---------------RVQAGY-HYVILGEHDRGSSAESVQVKSIAKAITHPY 110

  Fly   115 YNSGNLHNDISLIR-TPHVDFWSLVNKV-------ELPSYNDRYQDYAGWWAVASGWGGTYDGSP 171
            |||.|.:|||:|:: :......|.::.|       .:||         |...|.:|||.|...|.
Zfish   111 YNSQNFNNDITLLKLSSPAQLTSRISPVCLAASSTSIPS---------GTRCVTTGWGKTGSTSS 166

  Fly   172 LPDWLQSVDVQIISQSDCSRTWS---LHDNMICINTDGGKSTCGGDSGGPLVTHDGNR--LVGVT 231
             |..||...:.::|.:.|.:.|.   :.|.|||... .|.|:|.||||||||......  .||:.
Zfish   167 -PRILQQTALPLLSPAQCKQYWGQNRITDAMICAGA-SGVSSCQGDSGGPLVCESSGAWYQVGIV 229

  Fly   232 SFGSAAGCQSGAPAVFSRVTGYLDWI 257
            |:|: :.|....|||::||:....||
Zfish   230 SWGT-SDCNVRTPAVYARVSYLRQWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 83/252 (33%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 82/251 (33%)
Tryp_SPc 32..257 CDD:238113 83/252 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.