DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and cela1.6

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001003737.1 Gene:cela1.6 / 445282 ZFINID:ZDB-GENE-040808-55 Length:266 Species:Danio rerio


Alignment Length:274 Identity:81/274 - (29%)
Similarity:128/274 - (46%) Gaps:40/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LALAVAAATAVPAP---AQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWW--CGGS 66
            |.|:|.||.|:..|   .:::.       |.|:..|..|.....|:.:.|.:...|:::  |||:
Zfish     5 LLLSVLAALALAEPRYLEEQIA-------QERVVGGEVARPNSWPWQISLQYLSGGSYYHTCGGT 62

  Fly    67 IIGNTWVLTAAHCTNGASGVTINYGA-SIRTQPQYTHWVGSGDIIQHHHYNSGNL--HNDISLIR 128
            :|...:|||||||.:.:....:..|. .|..|.....::...::..|.::|..|:  ..||:|:|
Zfish    63 LIKQNFVLTAAHCVDTSRTWRVVLGEHDIYKQEGREQYMTVSNVYIHPNWNRNNVAAGYDIALLR 127

  Fly   129 -------TPHVDFWSLVNKVE-LPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIIS 185
                   ..:|...:|....: ||..|..|         .:|||.|..|..|...|:...:.::.
Zfish   128 LSSNASLNTYVQLGTLPPSGQVLPHNNACY---------ITGWGLTSTGGSLSAQLKQAYLPVVD 183

  Fly   186 QSDCSR-TW---SLHDNMICINTDGGKSTCGGDSGGPLVTHDGNRLV--GVTSFGSAAGCQS-GA 243
            .:.||| .|   ::.:.|:|.. .|..|.|.|||||||......:.|  |||||.|::||.: ..
Zfish   184 YNTCSRGDWWGSTVKNTMVCAG-GGSLSGCQGDSGGPLNCQVSGQYVVHGVTSFVSSSGCNAYQK 247

  Fly   244 PAVFSRVTGYLDWI 257
            |.||:||:.|:.||
Zfish   248 PTVFTRVSAYISWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 72/242 (30%)
cela1.6NP_001003737.1 Tryp_SPc 30..264 CDD:238113 72/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.