DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CG11842

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:274 Identity:69/274 - (25%)
Similarity:111/274 - (40%) Gaps:84/274 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ITNGYPAYEGKVPYIVGLLF---SGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQ 97
            |..|.||...:.|:...|..   :|...|:|||::|.:..|||||||.....| ::|...     
  Fly    73 IIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQG-SVNIAR----- 131

  Fly    98 PQYTHWVGS-----------------GDIIQHHHYNSGNLHNDISLIRTPH-VDFWSLVNKVELP 144
                  :|.                 .|...|..::...::||||::|... |.|....:...||
  Fly   132 ------LGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLP 190

  Fly   145 SYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSD---------------CSRTWS 194
            ..:.|    .|...:|.|||               .::|:.:::               |..|..
  Fly   191 FDDGR----LGTSFIAIGWG---------------QLEIVPRTENKKLQKVKLYNYGTRCRITAD 236

  Fly   195 LHDNM---------ICINTDGGKSTCGGDSGGPLVTHDGN-----RLVGVTSFGSAAGCQS-GAP 244
            .:|.:         :||.::..|.||.||||||::.:..:     .::|:||.|.|  |.: ..|
  Fly   237 RNDELPEGYNATTQLCIGSNEHKDTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVA--CDTPDLP 299

  Fly   245 AVFSRVTGYLDWIR 258
            |:::||..|||||:
  Fly   300 AMYTRVHFYLDWIK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 69/274 (25%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 69/274 (25%)
Tryp_SPc 73..312 CDD:214473 67/271 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437134
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.