DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CG16710

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:266 Identity:74/266 - (27%)
Similarity:119/266 - (44%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RITNGYPAYEGKVPYIVGLLFSGNG-NWW-------CGGSIIGNTWVLTAAHC--TNGASGVTIN 89
            ||..|......::|::..:|::... :.|       |.||:|.|.:|||||||  ..|.....:.
  Fly   105 RIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRITGLDLRRVR 169

  Fly    90 YGA-SIRTQPQ-YTHWVGSG---------DI---IQHHHYN--SGNLHNDISLIRTPH-VDFWSL 137
            .|. :|.:.|. .||..|..         |:   |:|.||.  ....:|||:|:|... |.:.:.
  Fly   170 LGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFEERPYNDIALLRLKFPVRYTAQ 234

  Fly   138 VNK--VEL------PSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWL--QSVDVQIISQSDCSRT 192
            :..  |:|      ||:::.....|| |.::...|  |....|..::  ::.|...:|:......
  Fly   235 IKPICVQLDYIFSNPSFSNHKLQIAG-WGLSHKQG--YSNVLLQAYVNGRNADECSLSEPSLGLD 296

  Fly   193 WSLHDNMICINTDGGKSTCGGDSGGPL--VTHDGNR----LVGVTSFGSAAGCQSGAPAVFSRVT 251
            ...|   ||....||..||.|||||||  :...|:.    |.|:||:|.:. |..| ||.:::.:
  Fly   297 KETH---ICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGYSQ-CGYG-PAAYTKTS 356

  Fly   252 GYLDWI 257
            .:::||
  Fly   357 KFVEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 73/265 (28%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855
Tryp_SPc 105..362 CDD:214473 72/264 (27%)
Tryp_SPc 106..362 CDD:238113 71/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436023
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.