DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CG31219

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:285 Identity:80/285 - (28%)
Similarity:126/285 - (44%) Gaps:56/285 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PAPAQKLTPTPIKDIQG------RITNGYPAYEGKVPYIVGLLFSGNGNW----WCGGSIIGNTW 72
            |.|..:|   |..:|.|      |:..|..|.....|::..||:......    :|.||:|.|.:
  Fly    68 PPPGNRL---PSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGSLINNRY 129

  Fly    73 VLTAAHCTNG----ASGVTINYGA-SIRTQPQYTHWVGSGD--------------IIQHHHYNS- 117
            |||:|||.||    .|..::..|. .|...|.|.......|              ||.|..::| 
  Fly   130 VLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVHGLFSSI 194

  Fly   118 --GNLHNDISLIRTP-HVDFWSLVNKVELPSYNDRYQDYAGWWAVA----SGWGGTYDGSPLPDW 175
              .|:..||:|:|.. .|.:.:.:..:.:|.:        |::|.:    :|||.|.:|. ....
  Fly   195 SNRNIEYDIALLRLKMPVRYRTGIMPICIPKH--------GFFAKSKLEIAGWGKTNEGQ-FSQV 250

  Fly   176 LQSVDVQIISQSDCSRTW---SLHDNM-ICINTDGGKSTCGGDSGGPL-VTHDGNR--LVGVTSF 233
            |....::..|.:.|:..:   .|:.:: ||.....|..||.||||||| ||.|.:.  |.|:|::
  Fly   251 LMHGFIRERSIAVCALRFPYLDLNQSLQICAGGYDGVDTCQGDSGGPLMVTMDNSSVYLAGITTY 315

  Fly   234 GSAAGCQSGAPAVFSRVTGYLDWIR 258
            ||....|.|.|.:::|.:.:|.||:
  Fly   316 GSKNCGQIGIPGIYTRTSAFLPWIK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 73/261 (28%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 72/259 (28%)
Tryp_SPc 90..342 CDD:238113 73/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436021
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.