DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CG31265

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:271 Identity:90/271 - (33%)
Similarity:134/271 - (49%) Gaps:29/271 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLALAVAAATAVPAPAQK---LTPTPIKDIQGRITNGYPAYEGKVPYIVGLL-FSGNGNW 61
            ||| :.|:|.:..|...|.|.:.   :.|.|... .|||..|..|..|..||.|.|. ..|:.| 
  Fly     1 MKL-LRLSLLILLAVKPPNPCESKRIVGPFPAGQ-SGRIKGGEEAEIGFAPYQVSLQPIVGSHN- 62

  Fly    62 WCGGSIIGNTWVLTAAHCTNGASGVTINY--GASIRTQPQYTHWVGSGDIIQHHHYNSGNLHNDI 124
             |||:|:...|::||.||........:|.  |.:...:|...::  :.:|.:|..|:...:||||
  Fly    63 -CGGAILNENWIITAGHCVENFIPALVNVITGTNKWAEPGAIYY--TAEIHKHCMYDQPYMHNDI 124

  Fly   125 SLIR-TPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGG--TYDGSPLPDWLQSVDVQIISQ 186
            :|:: |.::.|..|...:.||:...:    .|...|.:|||.  .| ||.:.| |..:.|.::..
  Fly   125 ALVKLTENITFNELTQPIALPTRPVQ----LGEEIVLTGWGSDVAY-GSSMED-LHKLTVGLVPL 183

  Fly   187 SDC----SRTWSLHDNMICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAVF 247
            .:|    :||.|:....||..:..|:..|.||||||||::  .:||||.::|..  |..|.|.|.
  Fly   184 DECYETFNRTSSMGVGHICTFSREGEGACHGDSGGPLVSN--GQLVGVVNWGRP--CGVGLPDVQ 244

  Fly   248 SRVTGYLDWIR 258
            :.|..||||||
  Fly   245 ANVYYYLDWIR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 78/233 (33%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 76/231 (33%)
Tryp_SPc 39..257 CDD:238113 77/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.