DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CG3505

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:241 Identity:66/241 - (27%)
Similarity:99/241 - (41%) Gaps:63/241 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 CGGSIIGNTWVLTAAHCTNGASGVTIN----------YGASIRTQPQYTHW-------------V 104
            |||.:|.:.:|||||||.  |...|.|          :..|.....|| |.             :
  Fly   137 CGGVLISDRYVLTAAHCV--AQAATSNLQITAVRLGEWDTSTNPDCQY-HEDSKVADCAPPYQDI 198

  Fly   105 GSGDIIQHHHYNSGNLH--NDISLIRTPHV----DFWSLVNKVELPS-------YNDRYQDYAGW 156
            ...:::.|..||..:..  |||:|:|....    ||   |..:.||:       ..|...:.|||
  Fly   199 AIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDF---VQPICLPNKQLRADELEDLVTEVAGW 260

  Fly   157 WAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRTWS-----LHDNMICINTDGGKSTCGGDSG 216
            .|.:|            ..::...|.|.|..:|.|.::     :..:.:|..|:  ...|.|::|
  Fly   261 QASSS------------QRMRKGYVTISSIEECQRKYASQQLRIQASKLCGLTN--SQECYGNAG 311

  Fly   217 GPLV--THDGNRLVGVTSFGSAAGCQSGAPAVFSRVTGYLDWIRDN 260
            |||:  .:||..|.|:.|||.........|.|::||..|:|||.|:
  Fly   312 GPLMLFKNDGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWIHDS 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 65/239 (27%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 65/238 (27%)
Tryp_SPc 111..354 CDD:214473 63/236 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436026
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.