DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CG31326

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:275 Identity:63/275 - (22%)
Similarity:120/275 - (43%) Gaps:45/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGN---WWCGGSIIGNTWVL 74
            ::..:|...::.:.||:      |..|.....|::|::|.:......|   :.|||::|..:.||
  Fly   257 SSNGIPCGRERASTTPL------IFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVL 315

  Fly    75 TAAHCTNG------ASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNL-HNDISLIR---- 128
            :||||...      ||.:.::.|.:.........:.|...:|.|.::..... ..|::|:|    
  Fly   316 SAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFRGVSQLIIHENFQFKQFTEADLALVRLDEP 380

  Fly   129 TPHVDF------WSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQS 187
            ..:.|:      ||..|:::||.         |..:..:|||....|:...:..:..|:.|:|::
  Fly   381 VRYTDYIVPICLWSTSNRMDLPQ---------GLKSYVAGWGPDETGTGNTEVSKVTDLNIVSEA 436

  Fly   188 DCSRTWS---LHDNMICINTDGGKSTCGGDSGGPLVTHDGNRLV--GVTSFG----SAAGCQSGA 243
            :|:....   :..:.:|....|. ..|..|.||||:..:.:..|  ||.|.|    ....|:...
  Fly   437 NCALELPHVLVQPSSLCAKKTGA-GPCASDGGGPLMLREQDVWVLRGVISGGVINEKENTCELSK 500

  Fly   244 PAVFSRVTGYLDWIR 258
            |:||:.|..:::|:|
  Fly   501 PSVFTDVAKHIEWVR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 60/252 (24%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 59/249 (24%)
Tryp_SPc 277..514 CDD:214473 57/246 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471154
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.