DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CG14088

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:226 Identity:48/226 - (21%)
Similarity:83/226 - (36%) Gaps:69/226 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EGKVPYIVGLLFSGNGNWWCG-----------GSIIGNTWVLTAAHCTNGASGVTINYGASIRTQ 97
            :|..|.|||.        |..           |::|...::||..||.:....:....|...|  
  Fly    36 DGLSPDIVGP--------WTAILHHFGRIVGVGTLIHERFILTDVHCGDSIGVIRARLGEYGR-- 90

  Fly    98 PQYTHWVGSGDIIQHH----HYNSGNLHND--------ISLIRT----PHVDFWSLVNKVELPSY 146
                  :|| ::.:.|    .:::.|.:.:        :.|:||    .|:....::....:.::
  Fly    91 ------IGS-ELAEDHIVAAFFSNANFNPETQANNMGLMKLLRTVVYKEHIIPVCILMDSRMQTF 148

  Fly   147 NDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRTWSLHDNMICINTDGGK--S 209
            .|....:.|     :.|..: |.||:   |:|..|..:.|: |.:   |.....|.   |.|  .
  Fly   149 ADELDYFNG-----TTWKNS-DKSPM---LRSKTVIRMPQA-CGK---LDHGQFCA---GHKDLD 197

  Fly   210 TCGGDSGGPL---VTHDG-NRLVGVTSFGSA 236
            :|...||..|   :.:.| ||.|   .||.|
  Fly   198 SCDEPSGAALTREIDYIGPNRTV---LFGIA 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 48/226 (21%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 46/220 (21%)
Tryp_SPc 42..248 CDD:214473 46/220 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.