DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and ctrb1

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_002944677.2 Gene:ctrb1 / 394984 XenbaseID:XB-GENE-977509 Length:263 Species:Xenopus tropicalis


Alignment Length:273 Identity:94/273 - (34%)
Similarity:131/273 - (47%) Gaps:38/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNW-WCGGSI 67
            |::|...:|.||.|....|... .|:.....||.||..|..|..|:.|.|  ..:.:| :||||:
 Frog     3 FLWLVSCLALATTVYGCGQPQI-APVVTGYARIVNGEEAVPGSWPWQVSL--QDSTSWHFCGGSL 64

  Fly    68 IGNTWVLTAAHCTNGASGVTINYGASIRTQPQY-THWVGS----------GDIIQHHHYNSGNLH 121
            |.|.||:|||||           |.|.|.:... .|..||          ..:..|..:||..::
 Frog    65 INNEWVVTAAHC-----------GVSTRDKVVLGEHDRGSNVEKIQSLAVAKVFTHPQWNSNTIN 118

  Fly   122 NDISLIR--TPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGT-YDGSPLPDWLQSVDVQI 183
            ||||||:  ||.| ..:.|..|.|.:..:.|:  .|...|.||||.| |:....|:.||...:.:
 Frog   119 NDISLIKLATPAV-IGATVAPVCLANIGEDYE--GGRICVTSGWGKTRYNAFTTPNQLQQTALPL 180

  Fly   184 ISQSDCSRTW--SLHDNMICINTDGGKSTCGGDSGGPLV--THDGNRLVGVTSFGSAAGCQSGAP 244
            ::...|...|  ::...|||... .|.|:|.||||||||  .:|...|||:.|:||:. |.:..|
 Frog   181 LTNDQCKSYWGNNITGTMICAGA-AGSSSCMGDSGGPLVCQANDAWTLVGIVSWGSSM-CSTSTP 243

  Fly   245 AVFSRVTGYLDWI 257
            ||::||.....|:
 Frog   244 AVYARVAVLRSWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 85/241 (35%)
ctrb1XP_002944677.2 Tryp_SPc 33..256 CDD:214473 85/240 (35%)
Tryp_SPc 34..259 CDD:238113 85/241 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.