DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CG18179

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:274 Identity:130/274 - (47%)
Similarity:168/274 - (61%) Gaps:15/274 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLALAVAAATAVPAPA---QKLTP--TPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGN 60
            ||||: |.|:||.|....:|.   ..|.|  |..:..:|||.|||||.|||.|||||||...:|:
  Fly     1 MKLFL-LTLSVALAVVAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGS 64

  Fly    61 WWC---GGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHN 122
            ...   .|:||.:.|:||||||.. ...|.|:||::......:...|...:.|.|.::.:.. ..
  Fly    65 NSAAVGAGTIIASDWILTAAHCLT-TDYVEIHYGSNWGWNGAFRQSVRRDNFISHPNWPAEG-GR 127

  Fly   123 DISLIRTPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQS 187
            ||.|||||.|.|..|:|||.|||:::....:...|.||.||||..:|: |.||||.:||||||.|
  Fly   128 DIGLIRTPSVGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDNGN-LADWLQCMDVQIISNS 191

  Fly   188 DCSRTW-SLHDNMICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAVFSRVT 251
            :|.::: ::....:|.....|||:|||||||||||||..|||||.:||| ..|.|| |:.::|||
  Fly   192 ECEQSYGTVASTDMCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITFGS-VDCHSG-PSGYTRVT 254

  Fly   252 GYLDWIRDNTGISY 265
            .||.||||||||||
  Fly   255 DYLGWIRDNTGISY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 108/227 (48%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 106/225 (47%)
Tryp_SPc 40..263 CDD:238113 108/227 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470731
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.