DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CG13527

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:264 Identity:69/264 - (26%)
Similarity:104/264 - (39%) Gaps:75/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PAYEGK-----VPYIVGL------LFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASI 94
            |.:.|.     ..|:|.:      .:.|: |.:|||.::.|.||:|||||..|.|  .|.|.|  
  Fly    30 PKFHGDETLELAKYVVSIRSRTPNKYFGD-NHYCGGGLLSNQWVITAAHCVMGQS--KIMYKA-- 89

  Fly    95 RTQPQYTHWV----GSGDIIQHHHYNSG----------------NLHNDISLI----------RT 129
                   .|:    ||...::   |..|                .:||..::.          ..
  Fly    90 -------RWLLVVAGSPHRLR---YTPGKSVCSPVSSLYVPKNFTMHNTFNMALMKLQEKMPSND 144

  Fly   130 PHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRTWS 194
            |.:.|..|..  |.|....|:        ...|||..|.|.||...:..|||.::..:.| :|:.
  Fly   145 PRIGFLHLPK--EAPKIGIRH--------TVLGWGRMYFGGPLAVHIYQVDVVLMDNAVC-KTYF 198

  Fly   195 LH--DNMICINTDG---GKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGCQSGAPAVFSRVTGYL 254
            .|  |.|:|...:.   ....|.||.|.||::  |..:||:.::....|| :..|:|::.|...|
  Fly   199 RHYGDGMMCAGNNNWTIDAEPCSGDIGSPLLS--GKVVVGIVAYPIGCGC-TNIPSVYTDVFSGL 260

  Fly   255 DWIR 258
            .|||
  Fly   261 RWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 69/264 (26%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 67/251 (27%)
Tryp_SPc 43..263 CDD:214473 64/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.