DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and Prss33

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_017173005.1 Gene:Prss33 / 353130 MGIID:2661234 Length:341 Species:Mus musculus


Alignment Length:261 Identity:74/261 - (28%)
Similarity:105/261 - (40%) Gaps:52/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 IQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASIRT 96
            :..||..|..|.:|:.|:...:  ...|...||||:|...|||||.||            ...|.
Mouse    94 MSSRIVGGRDAQDGEWPWQTSI--QHRGAHVCGGSLIAPQWVLTAGHC------------FPRRV 144

  Fly    97 QP-QYTHWVG--SGDIIQHHH-------------YNSGNLHNDISLIRTPH-VDFWSLVNKVELP 144
            .| :|:..:|  |.|:...|.             |:......|::|::..| |...:.:..|.||
Mouse   145 WPSEYSVLLGALSLDVRSSHELLVPVLRVLLPPDYSEDEARGDLALLQLRHPVSLSTRIQPVCLP 209

  Fly   145 SYNDRYQDYAGWWAVASGWGGTYDGSPLPDW--LQSVDVQIISQSDCSRTWSLHDNM-------- 199
            :........:..|  .:|||....|.|||..  ||.|.|.::....|.|.:.:..|:        
Mouse   210 APGSHPPPGSPCW--VTGWGSLSPGVPLPKGRPLQGVRVPLLDSRACDRLYHVGANVPQGERIVL 272

  Fly   200 ---ICIN-TDGGKSTCGGDSGGPLVTHDGNR--LVGVTSFGSAAGCQ-SGAPAVFSRVTGYLDWI 257
               :|.. ..|.|..|.|||||||...:...  ||||.|:|.  ||. ...|.|::.|..|..||
Mouse   273 PGNLCAGYRRGHKDACQGDSGGPLTCMESGHWVLVGVVSWGK--GCALPNRPGVYTNVAKYSPWI 335

  Fly   258 R 258
            :
Mouse   336 Q 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 73/257 (28%)
Prss33XP_017173005.1 Tryp_SPc 98..336 CDD:238113 72/255 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.