DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CG4650

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:262 Identity:62/262 - (23%)
Similarity:103/262 - (39%) Gaps:45/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LTPTP--IKDIQGR---ITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGA 83
            |.|.|  .:.:.||   :|||..|.....|: :..|.:....:.|||::|....||||||||..:
  Fly    14 LLPVPGSSQYLDGRCGLLTNGKIANNISSPW-MAYLHTSELLYVCGGTVITEKLVLTAAHCTRAS 77

  Fly    84 SGVTINYGASIRTQPQYTHWVGSGDIIQ---HHHYNSGNLHNDISL------------IRTPHVD 133
            ..:....|..|.|.......:....:.|   |..||:....|||::            ||...:.
  Fly    78 EQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPICIV 142

  Fly   134 FWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCS--RTWSLH 196
            :|::..|     |.|..|..:|     :.||...|.:. .|..:..|::....:.||  ...::.
  Fly   143 WWTIWRK-----YIDNIQVLSG-----AQWGLPNDRNE-SDAFRITDIRRQPANMCSTLNGTAIL 196

  Fly   197 DNMICINTDGGKSTCGGDSGGPL---VTHDGNR---LVGVTSFGSAAGCQSGAPAVFSRVTGYLD 255
            .:..|.. |.....|..|...||   :|....:   |:|:.:....  |:..  :|::.|..:.|
  Fly   197 SSQFCAG-DSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIATTNQK--CKRA--SVYTDVLSHTD 256

  Fly   256 WI 257
            :|
  Fly   257 FI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 57/245 (23%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 55/241 (23%)
Tryp_SPc 33..258 CDD:304450 55/241 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436034
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.