DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and Prss34

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:262 Identity:78/262 - (29%)
Similarity:109/262 - (41%) Gaps:57/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ITNGYPAYEGKVPYIVGL-LFSGNGNWW---CGGSIIGNTWVLTAAHCTN----GASGVTINYG- 91
            |..|.|....:.|:.|.| |:....:.|   ||||:|...||||||||..    .|.||.:..| 
Mouse    35 IVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLIHPQWVLTAAHCVRPKEVEAYGVRVQVGQ 99

  Fly    92 ------------ASIRTQPQYTHWV---GSGDIIQHHHYNSGNLHNDISLIRTPHVDFWSLVNKV 141
                        ..|...|:::..:   |..||        ..|..|..::.:.|      |..|
Mouse   100 LRLYENDQLMKVVKIIRHPKFSEKLSARGGADI--------ALLKLDTRVVLSEH------VYPV 150

  Fly   142 ELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPD--WLQSVDVQIISQSDC-----------SRTW 193
            .||:.:.|.......|  .:|||...:..|||.  .|:.|.|.|:..:||           |.|.
Mouse   151 SLPAASLRISSKKTCW--VAGWGVIENYMPLPPPYHLREVAVPIVENNDCEQKYQTNSSSDSTTR 213

  Fly   194 SLHDNMICINTDGGKSTCGGDSGGPLVTHDGNR--LVGVTSFGSAAGCQSGAPAVFSRVTGYLDW 256
            .:.|:|:|...: |:.:|..|||||||......  .|||.|:|...|... .|.|::||..|:.|
Mouse   214 IIKDDMLCAGKE-GRDSCKADSGGPLVCRWNCSWVQVGVVSWGIGCGLPD-FPGVYTRVMSYVSW 276

  Fly   257 IR 258
            |:
Mouse   277 IK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 78/262 (30%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 77/260 (30%)
Tryp_SPc 35..277 CDD:214473 76/259 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.