DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and Hayan

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:291 Identity:69/291 - (23%)
Similarity:121/291 - (41%) Gaps:57/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PAPAQKLTPTPI------------------------KDIQGRITNGYPAYEGKVPYIVGLLFS-- 56
            ||..:..||.|.                        |.:...|.:|.....|..|::..:.::  
  Fly   343 PAETRPTTPNPNPSRVNLPEKERPSVAACEKIRSGGKPLTVHILDGERVDRGVYPHMAAIAYNSF 407

  Fly    57 GNGNWWCGGSIIGNTWVLTAAHCTNGASGVT--INYGA-SIRT-QPQYTHWVGSGDIIQHHHYNS 117
            |:..:.||||:|.:.:|||||||.|......  :..|| :|.. :|.|.. :...|:..|..|:.
  Fly   408 GSAAFRCGGSLIASRFVLTAAHCVNSDDSTPSFVRLGALNIENPEPGYQD-INVIDVQIHPDYSG 471

  Fly   118 GNLHNDISLIRTPHVDFWSLVNKVELPS--YNDRYQDYAGWWAVASGWG-GTYDGSPLPDWLQSV 179
            .:.:.||::::....   :..:.|..|:  |.||....|.:....:||| .......:...|...
  Fly   472 SSKYYDIAILQLAED---AKESDVIRPACLYTDRSDPPANYKYFVAGWGVMNVTNRAVSKILLRA 533

  Fly   180 DVQIISQSDCSRTWS-------------LHDNMICINTDGGKSTCGGDSGGPLVTH----DGN-R 226
            .:.::...:|:.:::             :...:...:.:..|..|.|||||||:..    ||. .
  Fly   534 ALDLVPADECNASFAEQPSANRTLRRGVIASQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYS 598

  Fly   227 LVGVTSFGSAAGCQSGAPAVFSRVTGYLDWI 257
            :|||.|  |..||.:..|.:::||:.:||:|
  Fly   599 IVGVIS--SGFGCATKTPGLYTRVSSFLDYI 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 63/249 (25%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 62/248 (25%)
Tryp_SPc 385..630 CDD:238113 63/249 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437010
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.