DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and prss59.1

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_955899.2 Gene:prss59.1 / 322453 ZFINID:ZDB-GENE-030131-1173 Length:242 Species:Danio rerio


Alignment Length:271 Identity:81/271 - (29%)
Similarity:124/271 - (45%) Gaps:46/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGG 65
            |:..|||.| :.||.|:.              ..:|..||.......|:...|   .:|..:|||
Zfish     1 MRSLVFLVL-LGAAFALD--------------DDKIVGGYECQPNSQPWQASL---NSGYHFCGG 47

  Fly    66 SIIGNTWVLTAAHCTN-------GASGVTINYGASIRTQPQYTHWVGSGDIIQHHHYNSGNLHND 123
            |::...||::||||..       |...:.||.|..        .::.|..:|::.:|:|.:|.:|
Zfish    48 SLVSEYWVVSAAHCYKSRVEVRLGEHNIVINEGTE--------QFITSEKVIRNPNYDSWDLDSD 104

  Fly   124 ISLIR-TPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQS 187
            |.||: :........|..|.||  |....|  |.....||||.|...:...:.||.:::.|:|..
Zfish   105 IMLIKLSKPATLNKYVQPVALP--NGCAAD--GTMCRVSGWGNTMSSTADSNKLQCLEIPILSDR 165

  Fly   188 DCSRTW--SLHDNMICIN-TDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGC-QSGAPAVFS 248
            ||:.::  .:.|.|.|.. .:|||.:|.||||||:|.:  ..|.|:.|:|  .|| :...|.|:.
Zfish   166 DCNNSYPGMITDTMFCAGYLEGGKDSCQGDSGGPVVCN--GELHGIVSWG--YGCAEKNHPGVYG 226

  Fly   249 RVTGYLDWIRD 259
            :|..:..||.|
Zfish   227 KVCMFSQWIAD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 73/236 (31%)
prss59.1NP_955899.2 Tryp_SPc 20..235 CDD:214473 70/233 (30%)
Tryp_SPc 21..238 CDD:238113 73/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.