DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CG31205

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:244 Identity:59/244 - (24%)
Similarity:94/244 - (38%) Gaps:60/244 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHWVGSGD------ 108
            |||:...|:....|.|.:|.:..|:|||||.:.....:| ||...          |..|      
  Fly    55 IVGVTKDGSNTLLCTGILIDSRRVVTAAHCVSKDESESI-YGVVF----------GDSDSSNINL 108

  Fly   109 ---IIQHHHYNSGNLHNDISLIR-TPHVDFWSLVNKVELPSYNDRY--QDYAGWWAVASGWGGTY 167
               :..|..|:.....||:::|. |..|.|..||..:.|||.::..  .:.:....:.:|..|  
  Fly   109 VSAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEG-- 171

  Fly   168 DGSPLPDW------LQSVDVQI------ISQSDC-SRTWSLHDNMICINTDGGKSTCGGD----- 214
                 |.:      .|.:|.:|      |...:| .:.....:.:||.:|:  :|...|.     
  Fly   172 -----PSFDRRHSATQRLDKRIKMTYTKIDSKECHEKQARFPEELICGHTE--RSPLSGSALTEA 229

  Fly   215 SGGPLVTHDGNRLVG--VTSFGSAAGCQSGAPAVFSRVTGYLDWIRDNT 261
            ||.|...|    |:|  |..|.|:.....|    :..:..:||||..|:
  Fly   230 SGTPRQFH----LLGIAVAGFFSSDLDHQG----YLNIRPHLDWISKNS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 58/241 (24%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 31/123 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.