DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and sphinx1

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:283 Identity:74/283 - (26%)
Similarity:139/283 - (49%) Gaps:48/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLF----SGNGNW 61
            |||.|  .|.|.:.|.......||:|        ||..||.|....:.|:||:::    :.:.|:
  Fly     1 MKLVV--TLLVLSLTVSVGEKNKLSP--------RIAGGYRAKTFTIIYLVGIVYFKSQTSSLNY 55

  Fly    62 WCGGSIIGNTWVLTAAHCTNGASGVTINYG------ASIRTQPQYTHWVGSGDIIQ------HHH 114
            . .|:||.|.|:||..        ..:.|.      ||.|:...:       |||:      ..|
  Fly    56 G-AGTIISNQWILTVK--------TVLKYSYIEVHLASRRSYRGF-------DIIRIYKENFRFH 104

  Fly   115 YNSGNLHNDISLIRTPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSV 179
            |::.::   |:|::.|:..|...:::|.:|:|:.|::.|.|...:..|:|.....:.||:|::.:
  Fly   105 YDNDHV---IALVKCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCI 166

  Fly   180 DVQIISQSDCSRTWS-LHDNMICINTDGGKSTCGGDSGGPLVTHDGN-RLVGVTSFGSAAGCQSG 242
            :|::::.::|::.:: |....:|.:.:|.|..|.||.||.:||...| ..:|:. :.....|..|
  Fly   167 EVEVMNNTECAKYYTPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGII-WLMPENCSIG 230

  Fly   243 APAVFSRVTGYLDWIRDNTGISY 265
            .|:|..||:.::.||:..:|:.:
  Fly   231 YPSVHIRVSDHIKWIKRVSGVGF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 62/241 (26%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 61/239 (26%)
Tryp_SPc 26..248 CDD:304450 62/241 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470966
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.