DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and spirit

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:286 Identity:77/286 - (26%)
Similarity:124/286 - (43%) Gaps:52/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLALAVAAATAVPAPAQKL-----TPTPIKDIQG---RITNGYPAYEGKVPYIVGLLFSGNGN-- 60
            ::..|.|.|..|...:|:.     ..:.:|:|..   .:..|.|....:.|::..|.:..|.:  
  Fly    94 YVCCAPAVAPIVTRSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPREFPFMAALGWRSNFDQR 158

  Fly    61 --WWCGGSIIGNTWVLTAAHCTN-----------GASGVTINYGASIRTQPQYTHWVGSGDIIQH 112
              :.|||::|.|.:|||||||.:           |...:|:..|..|..:          .:|.|
  Fly   159 IYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLTLTEGEDISIR----------RVIIH 213

  Fly   113 HHYNSGNLHNDISLIRTPHVDFWSLVNKVEL-PSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWL 176
            ..|::...:|||:|:..      ....|.|| |:.....::.......|.|:|.|.........|
  Fly   214 PDYSASTAYNDIALLEL------ETAAKPELKPTCIWTQKEVTNTLVTAIGYGQTSFAGLSSAQL 272

  Fly   177 QSVDVQIISQSDCSRTWS--------LHDNMICINTDGGKSTCGGDSGGPLVTHDG--NRLVGVT 231
            ..|.::.:|..:|...:.        |...|...:..|.:.||.|||||||:..||  ..:||:|
  Fly   273 LKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLLMQDGLLGYVVGIT 337

  Fly   232 SFGSAAGCQSGAPAVFSRVTGYLDWI 257
            |.|.  ||.||.|:|::||:.::|||
  Fly   338 SLGQ--GCASGPPSVYTRVSSFVDWI 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 70/248 (28%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829 0/3 (0%)
Tryp_SPc 132..364 CDD:238113 70/248 (28%)
Tryp_SPc 132..361 CDD:214473 68/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437007
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.