DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and C1s2

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_776289.2 Gene:C1s2 / 317677 MGIID:3644269 Length:694 Species:Mus musculus


Alignment Length:273 Identity:75/273 - (27%)
Similarity:111/273 - (40%) Gaps:52/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSIIGNTWVLTAAHCTNGAS------ 84
            ||....:|.:|..|.||.....|:.|   |..:..  .||::|...|||||||.....|      
Mouse   434 PTEPFQVQQKIFGGQPAKIENFPWQV---FFNHPT--AGGALINEYWVLTAAHVVEKNSDPSMYA 493

  Fly    85 GVTINYGASI-RTQPQYTH-------WVGSGDIIQHHHYNSGNLHNDISLIRTPH-VDFWSLVNK 140
            |:|....|.: ..|..||.       |....|:...     .|..|||:|::... |......:.
Mouse   494 GITALRLADLENAQRLYTKRVIIHPGWKEDDDLNPR-----TNFDNDIALVQLKDPVKMGPKFSP 553

  Fly   141 VELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSRT-----------WS 194
            :.||..:..|....|...:.||||.|.....:.: |:...|.:.|...|.:.           :.
Mouse   554 ICLPGTSSEYNLSPGDMGLISGWGRTEKRLHVIN-LRGAKVPVTSLETCKQVKEENPTARPEDYV 617

  Fly   195 LHDNMICINTDGGKSTCGGDSGG------PLVTHDGNRLVGVTSFGSAAGCQSGAPAVFSRVTGY 253
            :.|||||.. :.|..:|.|||||      |.|......:.|:.|:|.    :.||..|:::|..|
Mouse   618 ITDNMICAG-EKGVDSCKGDSGGAFAFQVPNVKAPKFYVAGLVSWGK----KCGAYGVYTKVKNY 677

  Fly   254 LDWI----RDNTG 262
            :|||    ::|:|
Mouse   678 VDWILKTMQENSG 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 70/259 (27%)
C1s2NP_776289.2 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:291342
CUB 181..293 CDD:278839
CCP 300..361 CDD:153056
CCP 365..428 CDD:153056
Tryp_SPc 443..681 CDD:214473 68/253 (27%)
Tryp_SPc 444..684 CDD:238113 70/255 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.