DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and HABP2

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_004123.1 Gene:HABP2 / 3026 HGNCID:4798 Length:560 Species:Homo sapiens


Alignment Length:304 Identity:91/304 - (29%)
Similarity:131/304 - (43%) Gaps:87/304 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AAATAVP--APAQKLTPTPIKDIQG----------RITNGYPAYEGKVPYIVGLLFS-------G 57
            |...|.|  :|.:..|..|..|..|          ||..|:.:..||.|:...|..|       .
Human   278 AQDVAYPEESPTEPSTKLPGFDSCGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTISMP 342

  Fly    58 NGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASIRTQPQYTHW---VGSGD----------- 108
            .|: :|||::|...|||||||||:            |:|:    |.   :|..|           
Human   343 QGH-FCGGALIHPCWVLTAAHCTD------------IKTR----HLKVVLGDQDLKKEEFHEQSF 390

  Fly   109 ----IIQHHHYNSGN--LHNDISLIRTPHVD-FWSLVNKV---------ELPSYNDRYQDYAGWW 157
                |.::.|||..:  .||||:|::...|| ..:|.:|.         ..||.::.:       
Human   391 RVEKIFKYSHYNERDEIPHNDIALLKLKPVDGHCALESKYVKTVCLPDGSFPSGSECH------- 448

  Fly   158 AVASGWGGTYDGSPLPDWLQSVDVQIISQSDC-SRTWSLH---DNMICINT--DGGKSTCGGDSG 216
              .||||.|..|......|.: .|::|:.:.| ||....|   |:|||...  ..|:.||.||||
Human   449 --ISGWGVTETGKGSRQLLDA-KVKLIANTLCNSRQLYDHMIDDSMICAGNLQKPGQDTCQGDSG 510

  Fly   217 GPLVTH-DGNRLV-GVTSFGSAAGCQSGAPAVFSRVTGYLDWIR 258
            |||... ||...| |:.|:|...|.:   |.|:::||.:|:||:
Human   511 GPLTCEKDGTYYVYGIVSWGLECGKR---PGVYTQVTKFLNWIK 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 82/268 (31%)
HABP2NP_004123.1 EGF 77..106 CDD:306513
KR 191..277 CDD:238056
Tryp_SPc 314..553 CDD:238113 82/268 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.