DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and Cela3b

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001100162.1 Gene:Cela3b / 298567 RGDID:1307819 Length:269 Species:Rattus norvegicus


Alignment Length:269 Identity:83/269 - (30%)
Similarity:128/269 - (47%) Gaps:31/269 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNW--WCGGSIIGNT 71
            |.||.|:....|:  ..|:      .|:.||..|.....|:.|.|.:..:|::  .|||::|...
  Rat     9 LLVALASGCGQPS--YNPS------SRVVNGEDAVPYSWPWQVSLQYEKDGSFHHTCGGTLIAPD 65

  Fly    72 WVLTAAHCTNGASGVTINYG---ASIRTQPQYTHWVGSGDIIQHHHYNSG--NLHNDISLIR-TP 130
            ||:||.||.:.:....:..|   ..:...|:....|.:||:..|..:||.  :..|||:|:: :.
  Rat    66 WVMTAGHCISTSRTYQVVLGEFERGVEEGPEQVIPVNAGDLFVHPKWNSNCVSCGNDIALVKLSR 130

  Fly   131 HVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDCSR-TW- 193
            .......|....||...:...:.|..:  .||||......||||.||...:.::..:.||: .| 
  Rat   131 SAQLGDTVQLACLPPAGEILPNGAPCY--ISGWGRLSTNGPLPDKLQQALLPVVDYAHCSKWDWW 193

  Fly   194 --SLHDNMICINTDGG--KSTCGGDSGGPLVTHDGN---RLVGVTSFGSAAGCQS-GAPAVFSRV 250
              |:...|:|.   ||  :|.|.|||||||.....|   ::.|||||.|:.||.: ..|.||:||
  Rat   194 GFSVKKTMVCA---GGDIQSGCNGDSGGPLNCPAENGTWQVHGVTSFVSSLGCNTLKKPTVFTRV 255

  Fly   251 TGYLDWIRD 259
            :.:.:||.:
  Rat   256 SAFNEWIEE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 76/242 (31%)
Cela3bNP_001100162.1 Tryp_SPc 27..262 CDD:214473 75/239 (31%)
Tryp_SPc 28..265 CDD:238113 76/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.