DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and Mcpt2

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:207 Identity:69/207 - (33%)
Similarity:99/207 - (47%) Gaps:29/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 CGGSIIGNTWVLTAAHCTNGASGVTINYGA-SIRTQPQYTHWVGSGDIIQHHHYNS-GNLHNDIS 125
            |||.:|...:|||||||.  ...:|:..|| .:|.:......:.....|.|..||| .||| ||.
  Rat    50 CGGFLISRQFVLTAAHCK--GREITVILGAHDVRKRESTQQKIKVEKQIIHESYNSVPNLH-DIM 111

  Fly   126 LIR-TPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDWLQSVDVQIISQSDC 189
            |:: ...|:....||.|.|||.:|.....|..|  |:|||.|....|....|:.|:::|:.:..|
  Rat   112 LLKLEKKVELTPAVNVVPLPSPSDFIHPGAMCW--AAGWGKTGVRDPTSYTLREVELRIMDEKAC 174

  Fly   190 -SRTWSLHDNMICINTDGGKSTCG----GDSGGPL----VTHDGNRLVGVTSFGSAAGCQSGAPA 245
             ...:..:...:|:   |..:|..    |||||||    |.|      |:.|:|..   .:..||
  Rat   175 VDYRYYEYKFQVCV---GSPTTLRAAFMGDSGGPLLCAGVAH------GIVSYGHP---DAKPPA 227

  Fly   246 VFSRVTGYLDWI 257
            :|:||:.|:.||
  Rat   228 IFTRVSTYVPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 69/207 (33%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 67/205 (33%)
Tryp_SPc 21..242 CDD:238113 69/207 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.