DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and CG33462

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:225 Identity:55/225 - (24%)
Similarity:96/225 - (42%) Gaps:44/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 CGGSIIGNTWVLTAAHCTNGASGVTINYGA-SIRT----------QPQYTHWVGSGDIIQHHHYN 116
            |.|::|.:.:|||||||......:|:..|. :.:|          :|...:.|..|  .:|.:||
  Fly    61 CSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMG--FRHRYYN 123

  Fly   117 SGNLHNDISLIRTPHVDFWSLVNKVELPSY--------NDRYQDYAG--WWAVASGWGGTYDGSP 171
            :.:..|||.::|        |..:||..::        ::|:|:...  .|...:.|..| ..:.
  Fly   124 ANDQTNDIGMLR--------LGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRET-AANA 179

  Fly   172 LPDWLQSVDVQIISQSDCSRT--WSLHDNMICI-NTDGGKSTCGGDSGGPLVT---HDG-NRLVG 229
            ....|:::::....:..||..  |::....||. ||  ....|..|||.|.:.   |:| :|.|.
  Fly   180 TSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNT--LSQLCSTDSGAPQIRKMWHNGSDRYVQ 242

  Fly   230 VTSFGSAAG-CQSGAPAVFSRVTGYLDWIR 258
            :.......| ||:.  .:...:..|.|||:
  Fly   243 LGIASRVKGQCQNS--GILMDLLSYADWIK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 55/225 (24%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 55/225 (24%)
Tryp_SPc 48..269 CDD:214473 53/222 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436042
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.