DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and Tpsg1

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:256 Identity:76/256 - (29%)
Similarity:110/256 - (42%) Gaps:54/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GYPAYEGKVPYIVGLLFSGNGNW-W-----------CGGSIIGNTWVLTAAHCTNGA-------- 83
            |:|........|||...:..|.| |           ||||::...||||||||.:|:        
Mouse    76 GHPQVSNSGSRIVGGHAAPAGTWPWQASLRLHKVHVCGGSLLSPEWVLTAAHCFSGSVNSSDYQV 140

  Fly    84 --SGVTINYGASIRTQPQYTHWVGS----GDIIQHHHYNSGNLHNDISLIR-TPHVDFWSLVNKV 141
              ..:|:.......|..:...:.||    |        :||    ||:|:: :..|...|.|..|
Mouse   141 HLGELTVTLSPHFSTVKRIIMYTGSPGPPG--------SSG----DIALVQLSSPVALSSQVQPV 193

  Fly   142 ELPSYNDRYQDYAGWWAVASGWGGTYDGSPL--PDWLQSVDVQIISQSDCSRTWS------LHDN 198
            .||..:..:  |.|.....:|||.|.:|.||  |..||...|.::....||:.::      :..:
Mouse   194 CLPEASADF--YPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQPD 256

  Fly   199 MICINTDGGKSTCGGDSGGPLVTHDGN--RLVGVTSFGSAAGCQSGAPAVFSRVTGYLDWI 257
            |:|....|  ..|..|||||||.....  :..||.|:|...| :...|.|::|||.|::||
Mouse   257 MLCARGPG--DACQDDSGGPLVCQVAGTWQQAGVVSWGEGCG-RPDRPGVYARVTAYVNWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 76/256 (30%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 74/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.