DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon99Cii and PRSS33

DIOPT Version :9

Sequence 1:NP_524554.1 Gene:Jon99Cii / 43544 FlyBaseID:FBgn0003356 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:281 Identity:83/281 - (29%)
Similarity:115/281 - (40%) Gaps:37/281 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGGSI 67
            |.|.|.|.:.||   ....:|........:..||..|....:|:.|:...:  ...|...||||:
Human     7 LQVLLLLVLGAA---GTQGRKSAACGQPRMSSRIVGGRDGRDGEWPWQASI--QHRGAHVCGGSL 66

  Fly    68 IGNTWVLTAAHCTNG---ASGVTINYGASIR---TQPQYTHWVGSGDIIQHHHYNSGNLHNDISL 126
            |...||||||||...   .:...:..|| :|   |.|: |..|....::....|:......|::|
Human    67 IAPQWVLTAAHCFPRRALPAEYRVRLGA-LRLGSTSPR-TLSVPVRRVLLPPDYSEDGARGDLAL 129

  Fly   127 --IRTPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGSPLPDW--LQSVDVQIISQS 187
              :|.| |...:.|..|.||....|  ...|.....:|||....|.|||:|  ||.|.|.::...
Human   130 LQLRRP-VPLSARVQPVCLPVPGAR--PPPGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSR 191

  Fly   188 DCSRTWSLHDNM-----------ICIN-TDGGKSTCGGDSGGPLVTHDGNR--LVGVTSFGSAAG 238
            .|...:.:..::           :|.. ..|.|..|.|||||||.......  ||||.|:|.  |
Human   192 TCDGLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGK--G 254

  Fly   239 CQ-SGAPAVFSRVTGYLDWIR 258
            |. ...|.|::.|..|..||:
Human   255 CALPNRPGVYTSVATYSPWIQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon99CiiNP_524554.1 Tryp_SPc 36..260 CDD:238113 75/248 (30%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.